HOXA10 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of HELA using 85951-2-RR (same clone as 85951-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HELA cells using HOXA10 antibody (85951-2-RR, Clone: 250418A12 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85951-2-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 85951-2-RR (same clone as 85951-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using HOXA10 antibody (85951-2-RR, Clone: 250418A12 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85951-2-PBS in a different storage buffer formulation.

HOXA10 Uni-rAb^® Recombinant Antibody for IF/ICC, Indirect ELISA

Cat No. 85951-2-PBS

Clone No.250418A12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

Synonyms

homeobox A10, Homeobox protein Hox 1H, Homeobox protein Hox A10, Homeobox protein Hox-1.8, Homeobox protein Hox-1H

---

Product Information

85951-2-PBS targets HOXA10 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24156

  Product name: Recombinant human HOXA10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 203-311 aa of BC013971

  Sequence: YGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAA

• Full Name: homeobox A10
• Calculated Molecular Weight: 393 aa, 41 kDa
• GenBank Accession Number: BC013971
• Gene Symbol: HOXA10
• Gene ID (NCBI): 3206
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P31260
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HOXA10, also named as Homeobox protein Hox-A10, is a 410 amino acid protein, which contains 1 homeobox DNA-binding domain and belongs to the Abd-B homeobox family. HOXA10 localizes in the nucleus and can Interacts with SIRT2. HOXA10 as sequence-specific transcription factor, is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. HoxA10 expression increases during the midsecretory phase of the menstrual cycle, which corresponds with increased levels of circulating progesterone.