Filter:
Tested Applications
| Positive WB detected in | mouse heart tissue, rat heart tissue, human heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
86080-1-RR targets PLN in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag8632 Product name: Recombinant human PLN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC005269 Sequence: MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL Predict reactive species |
| Full Name | phospholamban |
| Calculated Molecular Weight | 52 aa, 6 kDa |
| Observed Molecular Weight | 10 kDa, 25 kDa |
| GenBank Accession Number | BC005269 |
| Gene Symbol | PLN |
| Gene ID (NCBI) | 5350 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P26678 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Phospholamban (PLN) is a 52-amino-acid transmembrane protein found in the sarcoplasmic reticulum (SR) of cardiac muscle cells. It has been postulated to regulate the activity of the calcium pump of cardiac sarcoplasmic reticulum. Phospholamban has a homopentamer form(25-27 kDa).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PLN antibody 86080-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
