WBSCR17 Recombinant monoclonal antibody

WBSCR17 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 86351-1-RR
Clone No.250868B10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

EC:2.4.1.41, GalNAc T like protein 3, GalNAc-T-like protein 3, GALNT17, Polypeptide GalNAc transferase-like protein 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue, fetal human brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86351-1-RR targets WBSCR17 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15792

Product name: Recombinant human WBSCR17 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-126 aa of BC069624

Sequence: MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSE

Predict reactive species
Full Name Williams-Beuren syndrome chromosome region 17
Calculated Molecular Weight 598 aa, 68 kDa
Observed Molecular Weight70~90 kDa
GenBank Accession NumberBC069624
Gene Symbol WBSCR17
Gene ID (NCBI) 64409
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6IS24
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WBSCR17, also known as GALNT17, which encodes a brain-expressed N-acetylgalactosaminyl transferase (GalNAcT), is located at the distal edge of a region that is commonly deleted or duplicated in Williams Beuren Syndrome (WBS), a developmental disorder with motor and coordination problems, impaired visuospatial memory, and abnormal social interaction (PMID: 31554716). WBSCR17 loss-of-function has significant effects on cerebellar development, and is associated with phenotypes including developmental delay, deficits in motor coordination, reduced exploratory activity, and impaired social behavior (PMID: 22787146). With the calculated molecular mass of recombinant WBSCR17 being 68 kDa, the 70-90-kDa glycoproteins could also be detected due to post-translational modifications (PMID: 22787146).

Protocols

Product Specific Protocols
WB protocol for WBSCR17 antibody 86351-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...