WBSCR17 Recombinant monoclonal antibody, PBS Only

WBSCR17 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 86351-1-PBS
Clone No.250868B10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

EC:2.4.1.41, GalNAc T like protein 3, GalNAc-T-like protein 3, GALNT17, Polypeptide GalNAc transferase-like protein 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86351-1-PBS targets WBSCR17 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15792

Product name: Recombinant human WBSCR17 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-126 aa of BC069624

Sequence: MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSE

Predict reactive species
Full Name Williams-Beuren syndrome chromosome region 17
Calculated Molecular Weight 598 aa, 68 kDa
Observed Molecular Weight70~90 kDa
GenBank Accession NumberBC069624
Gene Symbol WBSCR17
Gene ID (NCBI) 64409
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6IS24
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

WBSCR17, also known as GALNT17, which encodes a brain-expressed N-acetylgalactosaminyl transferase (GalNAcT), is located at the distal edge of a region that is commonly deleted or duplicated in Williams Beuren Syndrome (WBS), a developmental disorder with motor and coordination problems, impaired visuospatial memory, and abnormal social interaction (PMID: 31554716). WBSCR17 loss-of-function has significant effects on cerebellar development, and is associated with phenotypes including developmental delay, deficits in motor coordination, reduced exploratory activity, and impaired social behavior (PMID: 22787146). With the calculated molecular mass of recombinant WBSCR17 being 68 kDa, the 70-90-kDa glycoproteins could also be detected due to post-translational modifications (PMID: 22787146).

Loading...
||
New chat

Able

正在加载,请稍候...