Tested Applications
| Positive WB detected in | mouse liver tissue, HEK-293 cells, PC-3 cells, PC-12 cells |
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
87047-1-RR targets ABCD3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag24760 Product name: Recombinant human ABCD3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-124 aa of BC068509 Sequence: MAAFSKYLTARNSSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFFSRLIQILKIMVPRTFCKETGYLVLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSRKDFKR Predict reactive species |
| Full Name | ATP-binding cassette, sub-family D (ALD), member 3 |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC068509 |
| Gene Symbol | ABCD3 |
| Gene ID (NCBI) | 5825 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P28288 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ABCD3 belongs to the superfamily of ATP-binding cassette (ABC) transporters and is a peroxisomal membrane transporter involved in the transport of branched-chain fatty acids and C27 bile acids into the peroxisome. ABCD3 plays a role in the regulation of LCFAs and energy metabolism, namely in the degradation and biosynthesis of fatty acids via beta-oxidation (PMID: 24333844). Mutations in ABCD3 are associated with congenital bile acid synthesis defect 5 (CBAS5)(PMID: 25168382).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ABCD3 antibody 87047-1-RR | Download protocol |
| WB protocol for ABCD3 antibody 87047-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







