ABCD3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse liver using 87047-1-RR (same clone as 87047-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 87047-1-RR (ABCD3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87047-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87047-1-RR (same clone as 87047-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87047-1-RR (ABCD3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87047-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 87047-1-RR (same clone as 87047-1-PBS)

  WB result of ABCD3 antibody (87047-1-RR; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-ABCD3 transfected HEK-293 cells. This data was developed using the same antibody clone with 87047-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 87047-1-RR (same clone as 87047-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed PC-3 cells using ABCD3 antibody (87047-1-RR, Clone: 252233H1 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87047-1-PBS in a different storage buffer formulation.

ABCD3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 87047-1-PBS

Clone No.252233H1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ATP-binding cassette sub-family D member 3, EC:3.1.2.-, PMP70, PXMP1

---

Product Information

87047-1-PBS targets ABCD3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24760

  Product name: Recombinant human ABCD3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-124 aa of BC068509

  Sequence: MAAFSKYLTARNSSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFFSRLIQILKIMVPRTFCKETGYLVLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSRKDFKR

• Full Name: ATP-binding cassette, sub-family D (ALD), member 3
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC068509
• Gene Symbol: ABCD3
• Gene ID (NCBI): 5825
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P28288
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ABCD3 belongs to the superfamily of ATP-binding cassette (ABC) transporters and is a peroxisomal membrane transporter involved in the transport of branched-chain fatty acids and C27 bile acids into the peroxisome. ABCD3 plays a role in the regulation of LCFAs and energy metabolism, namely in the degradation and biosynthesis of fatty acids via beta-oxidation (PMID: 24333844). Mutations in ABCD3 are associated with congenital bile acid synthesis defect 5 (CBAS5)(PMID: 25168382).