Tested Applications
| Positive WB detected in | SH-SY5Y cells, K-562 cells, THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
87115-2-RR targets STAC2 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag16601 Product name: Recombinant human STAC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 65-154 aa of BC109231 Sequence: TLRYGTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRKDVGPMYS Predict reactive species |
| Full Name | SH3 and cysteine rich domain 2 |
| Calculated Molecular Weight | 411 aa, 45 kDa |
| Observed Molecular Weight | 55-57 kDa |
| GenBank Accession Number | BC109231 |
| Gene Symbol | STAC2 |
| Gene ID (NCBI) | 342667 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q6ZMT1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
STAC2 (Src homology 3 and cysteine-rich domain 2) contains an SH3 domain and a zinc finger domain. STAC2 has been shown to negatively regulate osteoclast formation by targeting the RANK signaling complex. This mechanism involves inhibiting the formation of complexes containing Gab2 and PLCγ2, thereby suppressing NF-κB and MAPK signaling pathways.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for STAC2 antibody 87115-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



