STAC2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87115-2-RR (same clone as 87115-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87115-2-RR (STAC2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87115-2-PBS in a different storage buffer formulation.

• 

  Affinity of 87115-2-RR

  Biolayer interferometry (BLl) kinetic assays of 87115-2-RR against Human STAC2 were performed. The affinity constant is 7.03 nM.

STAC2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87115-2-PBS

Clone No.251759B12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

24b2, 24b2/STAC2, SH3 and cysteine rich domain 2, SH3 and cysteine-rich domain-containing protein 2, Src homology 3 and cysteine-rich domain-containing protein 2

---

Product Information

87115-2-PBS targets STAC2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16601

  Product name: Recombinant human STAC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 65-154 aa of BC109231

  Sequence: TLRYGTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRKDVGPMYS

• Full Name: SH3 and cysteine rich domain 2
• Calculated Molecular Weight: 411 aa, 45 kDa
• Observed Molecular Weight: 55-57 kDa
• GenBank Accession Number: BC109231
• Gene Symbol: STAC2
• Gene ID (NCBI): 342667
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6ZMT1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STAC2 (Src homology 3 and cysteine-rich domain 2) contains an SH3 domain and a zinc finger domain. STAC2 has been shown to negatively regulate osteoclast formation by targeting the RANK signaling complex. This mechanism involves inhibiting the formation of complexes containing Gab2 and PLCγ2, thereby suppressing NF-κB and MAPK signaling pathways.