Tested Applications
| Positive WB detected in | HeLa cells, mouse skeletal muscle tissue, HepG2 cells, Jurkat cells, human skeletal muscle tissue, rat skeletal muscle tissue, mouse liver tissue |
| Positive IHC detected in | rat liver tissue, mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
87199-1-RR targets UQCRQ in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag6907 Product name: Recombinant human UQCRQ protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-82 aa of BC001390 Sequence: MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK Predict reactive species |
| Full Name | ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC001390 |
| Gene Symbol | UQCRQ |
| Gene ID (NCBI) | 27089 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O14949 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UQCRQ(Cytochrome b-c1 complex subunit 8) belongs to the UQCRQ/QCR8 family. UQCRQ is a ubiquinone-binding protein localized to the cytochrome bc1 region of the mitochondrial respiratory chain. The deduced 110-amino acid protein has a relatively hydrophobic and basic N-terminal region, an aspartic acid-rich middle region, and a glutamic acid- and lysine-rich C-terminal region.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for UQCRQ antibody 87199-1-RR | Download protocol |
| IHC protocol for UQCRQ antibody 87199-1-RR | Download protocol |
| WB protocol for UQCRQ antibody 87199-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











