UQCRQ Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87199-1-RR (same clone as 87199-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87199-1-RR (UQCRQ antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87199-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87199-1-RR (same clone as 87199-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87199-1-RR (UQCRQ antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87199-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 87199-1-RR (same clone as 87199-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 87199-1-RR (UQCRQ antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87199-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 87199-1-RR (same clone as 87199-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 87199-1-RR (UQCRQ antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87199-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 87199-1-RR (same clone as 87199-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using UQCRQ antibody (87199-1-RR, Clone: 252364C10 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 87199-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87199-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87199-1-RR against Human UQCRQ were performed. The affinity constant is 2.79 nM.

UQCRQ Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 87199-1-PBS

Clone No.252364C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Complex III subunit 8, Complex III subunit VIII, Cytochrome b-c1 complex subunit 8, QCR8, QP C

---

Product Information

87199-1-PBS targets UQCRQ in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6907

  Product name: Recombinant human UQCRQ protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-82 aa of BC001390

  Sequence: MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK

• Full Name: ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC001390
• Gene Symbol: UQCRQ
• Gene ID (NCBI): 27089
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14949
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UQCRQ(Cytochrome b-c1 complex subunit 8) belongs to the UQCRQ/QCR8 family. UQCRQ is a ubiquinone-binding protein localized to the cytochrome bc1 region of the mitochondrial respiratory chain. The deduced 110-amino acid protein has a relatively hydrophobic and basic N-terminal region, an aspartic acid-rich middle region, and a glutamic acid- and lysine-rich C-terminal region.