Mouse CD297/ART4 Recombinant monoclonal antibody, PBS Only (Detector)

CD297/ART4 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 87399-1-PBS
Clone No.252721F4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Cytometric bead array, Indirect ELISA

ADP-ribosyltransferase C2 and C3 toxin-like 4, Art4, ARTC4, CD297, EC:2.4.2.31

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87399-1-PBS targets CD297/ART4 as part of a matched antibody pair:

MP03043-1: 87399-2-PBS capture and 87399-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg6315

Product name: Recombinant mouse CD297/ART4 protein

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 24-263 aa of NM_026639.2

Sequence: GSTEAPLKVDVDLTPDSFDDQYQGCSEQMVEELNQGDYFIKEVDTHKYYSRAWQKAHLTWLNQAKALPESMTPVHAVAIVVFTLNLNVSSDLAKAMARAAGSPGQYSQSFHFKYLHYYLTSAIQLLRKDSSTKNGSLCYKVYHGMKDVSIGANVGSTIRFGQFLSASLLKEETRVSGNQTLFTIFTCLGASVQDFSLRKEVLIPPYELFEVVSKSGSPKGDLINLRSAGNMSTYNCQLLK

Predict reactive species
Full Name ADP-ribosyltransferase 4
Calculated Molecular Weight 33 kDa
Observed Molecular Weight33 kDa
GenBank Accession NumberNM_026639.2
Gene Symbol Art4
Gene ID (NCBI) 109978
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9CRA0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD297/ART4 is a GPI-anchored ecto-ADP-ribosyltransferase best known as the molecular carrier of Dombrock blood group antigens on erythrocytes. Expressed on red blood cells, hematopoietic progenitors, and select immune cells, it participates in cell-surface signaling and immune recognition, though its catalytic activity is limited. CD297/ART4 polymorphisms underlie clinically significant transfusion reactions, making it a key target in hematology, transfusion medicine, and erythroid biology.

Loading...
||
New chat

Able

正在加载,请稍候...