CD297/ART4 Recombinant monoclonal antibody

• 

  WB analysis using 87399-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87399-1-RR (CD297/ART4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87399-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87399-1-RR (CD297/ART4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87399-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87399-1-RR against Mouse CD297/ART4 were performed. The affinity constant is 1.40 nM.

CD297/ART4 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87399-1-RR

Clone No.252721F4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

ADP-ribosyltransferase C2 and C3 toxin-like 4, Art4, ARTC4, CD297, EC:2.4.2.31

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, mouse thymus tissue, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87399-1-RR targets CD297/ART4 in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6315

  Product name: Recombinant mouse CD297/ART4 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-263 aa of NM_026639.2

  Sequence: GSTEAPLKVDVDLTPDSFDDQYQGCSEQMVEELNQGDYFIKEVDTHKYYSRAWQKAHLTWLNQAKALPESMTPVHAVAIVVFTLNLNVSSDLAKAMARAAGSPGQYSQSFHFKYLHYYLTSAIQLLRKDSSTKNGSLCYKVYHGMKDVSIGANVGSTIRFGQFLSASLLKEETRVSGNQTLFTIFTCLGASVQDFSLRKEVLIPPYELFEVVSKSGSPKGDLINLRSAGNMSTYNCQLLK

• Full Name: ADP-ribosyltransferase 4
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: NM_026639.2
• Gene Symbol: Art4
• Gene ID (NCBI): 109978
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9CRA0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD297/ART4 is a GPI-anchored ecto-ADP-ribosyltransferase best known as the molecular carrier of Dombrock blood group antigens on erythrocytes. Expressed on red blood cells, hematopoietic progenitors, and select immune cells, it participates in cell-surface signaling and immune recognition, though its catalytic activity is limited. CD297/ART4 polymorphisms underlie clinically significant transfusion reactions, making it a key target in hematology, transfusion medicine, and erythroid biology.