CCL4/MIP-1 beta Recombinant monoclonal antibody

CCL4/MIP-1 beta Uni-rAb® Recombinant Antibody for WB, IF/ICC, IP, ELISA
Cat No. 87439-1-RR
Clone No.251973B10

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IF/ICC, IP, ELISA

C-C motif chemokine 4, Ccl4, CCL-4, Macrophage inflammatory protein 1-beta, MIP-1 beta

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPMA, LPS and Brefeldin A treated RAW 264.7 cells
Positive IP detected inPMA, LPS and Brefeldin A treated NR8383 cells
Positive IF/ICC detected inPMA, LPS and Brefeldin A treated NR8383 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

87439-1-RR targets CCL4/MIP-1 beta in WB, IF/ICC, IP, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3200

Product name: recombinant rat CCL4/MIP-1 beta protein

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 24-92 aa of NM_053858.1

Sequence: APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQICADPSEPWVNEYVNDLELN

Predict reactive species
Full Name chemokine (C-C motif) ligand 4
Calculated Molecular Weight10 kDa
Observed Molecular Weight10 kDa
GenBank Accession NumberNM_053858.1
Gene Symbol Ccl4
Gene ID (NCBI) 116637
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP50230
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCL4 (C-C motif chemokine ligand 4), also known as macrophage inflammatory protein-1β (MIP-1β), is a pivotal chemokine that governs immune cell migration and activation. By binding primarily to its receptor CCR5, it directs the recruitment of monocytes, dendritic cells, natural killer (NK) cells, and T lymphocytes to sites of inflammation and infection. CCL4 plays a crucial role in antiviral defense, antitumor immunity, and inflammatory responses. However, dysregulated CCL4 signaling is implicated in the pathogenesis of chronic inflammatory diseases, autoimmune disorders, and cancer progression. Notably, due to its shared use of the CCR5 receptor with HIV-1, CCL4 also participates in HIV pathogenesis. This dual role as a mediator of both protective immunity and pathology positions CCL4 as a significant biomarker and a promising therapeutic target in immunology and medicine.

Protocols

Product Specific Protocols
IF protocol for CCL4/MIP-1 beta antibody 87439-1-RRDownload protocol
IP protocol for CCL4/MIP-1 beta antibody 87439-1-RRDownload protocol
WB protocol for CCL4/MIP-1 beta antibody 87439-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...