Rat CCL4/MIP-1 beta Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of RAW 264.7 using 87439-1-RR (same clone as 87439-1-PBS)

  PMA, LPS and Brefeldin A treated RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 87439-1-RR (CCL4/MIP-1 beta antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87439-1-PBS in a different storage buffer formulation.

• 

  IP experiment of NR8383 using 87439-1-RR (same clone as 87439-1-PBS)

  IP result of anti-CCL4/MIP-1 beta (IP:87439-1-RR, 4ug; Detection:87439-1-RR 1:1000) with PMA, LPS and Brefeldin A treated NR8383 cells lysate 800 ug. This data was developed using the same antibody clone with 87439-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NR8383 using 87439-1-RR (same clone as 87439-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PMA, LPS and Brefeldin A treated NR8383 cells using CCL4/MIP-1 beta antibody (87439-1-RR, Clone: 251973B10 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87439-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP03044-1

  Rat peripheral blood mononuclear cells cells(PBMC)(1.0 x 106cells/mL) were cultured in DMEM supplemented with 8% fetal bovine serum, 2.5 mM L-glutamine, 100 U/mL penicillin, and 100 μg/mL streptomycin sulfate. Cells were cultured stimulated or unstimulated with 10 μg/mL PHA for 3 days. Aliquots of the cell culture supernates were removed and assayed for levels of rat CCL4/MIP-1 beta, and measured 5102.7 pg/mL, 2247.5 pg/mL, respectively.

• 

  Cytometric bead array standard curve of MP03044-1

  Cytometric bead array standard curve of MP03044-1, RAT CCL4/MIP-1 beta Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87439-1-PBS. Detection antibody: 87439-2-PBS. Standard: Eg3200. Range: 0.156-10 ng/mL.

• 

  Affinity of 87439-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87439-1-RR against Rat CCL4/MIP-1 beta were performed. The affinity constant is 1.16 nM.

CCL4/MIP-1 beta Uni-rAb^® Recombinant Antibody for WB, IF/ICC, IP, Cytometric bead array, Indirect ELISA

Cat No. 87439-1-PBS

Clone No.251973B10

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IF/ICC, IP, Cytometric bead array, Indirect ELISA

Synonyms

C-C motif chemokine 4, Ccl4, CCL-4, Macrophage inflammatory protein 1-beta, MIP-1 beta

---

Product Information

87439-1-PBS targets CCL4/MIP-1 beta as part of a matched antibody pair:

MP03044-1: 87439-1-PBS capture and 87439-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3200

  Product name: recombinant rat CCL4/MIP-1 beta protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 24-92 aa of NM_053858.1

  Sequence: APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQICADPSEPWVNEYVNDLELN

• Full Name: chemokine (C-C motif) ligand 4
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: NM_053858.1
• Gene Symbol: Ccl4
• Gene ID (NCBI): 116637
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P50230
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCL4 (C-C motif chemokine ligand 4), also known as macrophage inflammatory protein-1β (MIP-1β), is a pivotal chemokine that governs immune cell migration and activation. By binding primarily to its receptor CCR5, it directs the recruitment of monocytes, dendritic cells, natural killer (NK) cells, and T lymphocytes to sites of inflammation and infection. CCL4 plays a crucial role in antiviral defense, antitumor immunity, and inflammatory responses. However, dysregulated CCL4 signaling is implicated in the pathogenesis of chronic inflammatory diseases, autoimmune disorders, and cancer progression. Notably, due to its shared use of the CCR5 receptor with HIV-1, CCL4 also participates in HIV pathogenesis. This dual role as a mediator of both protective immunity and pathology positions CCL4 as a significant biomarker and a promising therapeutic target in immunology and medicine.