4921513D23Rik Fusion Protein

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Liquid

Cat no : Ag13709

Synonyms

BC031575; C87306; E030019O05; KIAA0430; LKAP; MGC36956; mKIAA0430



Product Information

Peptide Sequence QFVKLLRSQKGNCLMMTDLFTEYAKTFGYTFRLQDYDVSSVSALTQKLCHVVKVADMESGKQIQLINRKSLRSLTAQLLVLLMSWEGDAYLPVDELRRHYETTHSTPLNPCEYGFMTLTELLKSLPYLVEVCTNDKAEEYVKLTSLYLFAKNVRSLLHTYHYQQIFLHEFSMAYNKYVGETLQPKTYGYSSVEELLGAIPQVVWIKGHGHKRIVVLKNDMKNRLSSFDLFSVNHEDQPAVSRQILAVPESHLASELQLRTGPSQMEQELLHLASSSPVDLLCAPVPSCLPSPQLRPDPVILKPADLIQFEEHP
(1340-1652 aa encoded by NM_001081154)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8. ) added with 100mM GSH and 15%glycerol.