• Featured Product
  • KD/KO Validated

4EBP1 Monoclonal antibody

4EBP1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60246-1-Ig
Clone No.2C3F3

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig and More (1)

Applications

WB, IHC, IF/ICC, ELISA

EIF4EBP1, 2C3F3, 4E BP1, 4E-BP1, BP 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, HCT 116 cells, K562, NCI-H1299 cells
Positive IHC detected inhuman pancreas cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60246-1-Ig targets 4EBP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Cited Reactivityhuman, chicken
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18985

Product name: Recombinant human 4EBP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-118 aa of BC004459

Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Predict reactive species
Full Name eukaryotic translation initiation factor 4E binding protein 1
Calculated Molecular Weight 118 aa, 12 kDa
Observed Molecular Weight 15-24 kDa
GenBank Accession NumberBC004459
Gene Symbol EIF4EBP1
Gene ID (NCBI) 1978
RRIDAB_2881368
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13541
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Eukaryotic translation initiation factor 4E-binding protein 1(4EBP1), is a member of 4EBPs family, which regulate the translation of a subset of mRNA by competing with eIF4G for binding to eIF4E, thus preventing the assembly of the eIF4F complex. The eIF4F facilitates the recruitment of other translation initiation factors to form the complex and then initiates cap-dependent translation.4EBP1 also mediates the regulation of protein translation by growth factors, hormones and other stimuli that signal through the MAP kinase and mTORC1 pathways. There are three forms of 4EBP1, alpha, beta and gamma.typical pattern seen on Western blots for phosphorylated heat-acid stabled protein 4EBP1 from rat gastrocnemius muscle. Three distinct bands are noted, with the most rapidly migrating band having an apparent molecular mass of ; 20 kDa and the slowest migrating band of; 24 kDa. The 3 bands are designated by convention as alpha, beta and gamma. (PMID: 10913029)

Protocols

Product Specific Protocols
IF protocol for 4EBP1 antibody 60246-1-IgDownload protocol
IHC protocol for 4EBP1 antibody 60246-1-IgDownload protocol
WB protocol for 4EBP1 antibody 60246-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Nature

Feeding induces cholesterol biosynthesis via the mTORC1-USP20-HMGCR axis.

Authors - Xiao-Yi Lu

J Hepatol

OGDHL silencing promotes hepatocellular carcinoma by reprogramming glutamine metabolism.

Authors - Weiqi Dai
humanIHC

Mol Cancer

The circular RNA circ-ERBIN promotes growth and metastasis of colorectal cancer by miR-125a-5p and miR-138-5p/4EBP-1 mediated cap-independent HIF-1α translation.

Authors - Liang-Yan Chen
WB

Sci Adv

Citrulline regulates macrophage metabolism and inflammation to counter aging in mice

Authors - Zhangdan Xie
humanWB

Cell Death Differ

Lysine methylation of PPP1CA by the methyltransferase SUV39H2 disrupts TFEB-dependent autophagy and promotes intervertebral disc degeneration

Authors - Huaizhen Liang
humanWB

Autophagy

STYK1 promotes autophagy through enhancing the assembly of autophagy-specific class III phosphatidylinositol 3-kinase complex I.

Authors - Cefan Zhou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Reyes (Verified Customer) (12-06-2024)

EIF4EBP1 worked well enugh in my FFPE human cortex marking my neurons (in red)

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
4EBP1 Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:60246-1-Ig)
FH

Tom (Verified Customer) (03-02-2021)

10ug of HEK293 lysate resolved on 4-20% gradient acrylamide gel. Membrane blocked (5% BSA) then incubated overnight with antibody (1:2,000). Incubated with secondary HRP antibody for visulization.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HEK293
4EBP1 Antibody Western Blot validation (1:2000 dilution) in HEK293 (Cat no:60246-1-Ig)
FH

Yifei (Verified Customer) (11-01-2017)

It works well for Western blot

  • Applications: Western Blot
Loading...
||
New chat

Able

正在加载,请稍候...