5 Lipoxygenase Recombinant monoclonal antibody

• 

  WB analysis using 83794-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83794-4-RR (ALOX5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovarian cancer using 83794-4-RR

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 83794-4-RR (5 Lipoxygenase antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 83794-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83794-4-RR against Human 5 Lipoxygenase were performed. The affinity constant is 0.392 nM.

5 Lipoxygenase Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 83794-4-RR

Clone No.240740A10

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

ALOX5, 5-LO, 5LO, 5-lipoxygenase, 5 LOX

---

Tested Applications

• Positive WB detected in: HL-60 cells, THP-1 cells, human placenta tissue
• Positive IHC detected in: human ovarian cancer; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

83794-4-RR targets 5 Lipoxygenase in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19503

  Product name: Recombinant human ALOX5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-349 aa of BC130332

  Sequence: MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWL

• Full Name: arachidonate 5-lipoxygenase
• Calculated Molecular Weight: 674 aa, 78 kDa
• Observed Molecular Weight: 70-78 kDa
• GenBank Accession Number: BC130332
• Gene Symbol: 5 Lipoxygenase
• Gene ID (NCBI): 240
• RRID: AB_3671385
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P09917
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ALOX5(arachidonate 5-lipoxygenase) is also named as LOG5, 5-LO and belongs to the lipoxygenase family. It catalyzes the first step in leukotriene biosynthesis, and plays a role in inflammatory processes. It is a 78 kDa iron-containing enzyme that translocates from the cytosol to associate with FLAP, and converts arachidonate in two steps into the unstable intermediate LTA4. It is essential for cysteinyl-leukotriene (cys-LT) production, critical mediators in asthma(PMID:12911785).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncol Lett; Overexpression and knockdown of 5-lipoxygenase regulates the migration and invasion of colorectal cancer cells.; Authors - Xuyang Li ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Nazek (Verified Customer) (07-23-2025)

saw multiple bands

• Applications: Cell culture
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: SK-N-BE(2)

5 Lipoxygenase Antibody Cell culture validation (1:1000 dilution) in SK-N-BE(2) (Cat no:83794-4-RR)