Tested Applications
| Positive WB detected in | mouse liver tissue |
| Positive IHC detected in | mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
25812-1-AP targets A1CF in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22929 Product name: Recombinant human A1CF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC054873 Sequence: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIR Predict reactive species |
| Full Name | APOBEC1 complementation factor |
| Calculated Molecular Weight | 594 aa, 65 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC054873 |
| Gene Symbol | A1CF |
| Gene ID (NCBI) | 29974 |
| RRID | AB_3669501 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NQ94 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
A1CF, also known as Apobec-1 complementation factor, is an RNA-binding protein that plays a crucial role in the post-transcriptional editing of apolipoprotein B (apoB) mRNA. It is a component of the enzyme complex responsible for converting a CAA codon for glutamine to a UAA stop codon in apoB mRNA, resulting in the production of a truncated protein, apoB48, instead of the full-length apoB100.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for A1CF antibody 25812-1-AP | Download protocol |
| WB protocol for A1CF antibody 25812-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





