Tested Applications
Positive WB detected in | mouse liver tissue |
Positive IHC detected in | mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
25812-1-AP targets A1CF in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22929 Product name: Recombinant human A1CF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC054873 Sequence: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIR Predict reactive species |
Full Name | APOBEC1 complementation factor |
Calculated Molecular Weight | 594 aa, 65 kDa |
Observed Molecular Weight | 65 kDa |
GenBank Accession Number | BC054873 |
Gene Symbol | A1CF |
Gene ID (NCBI) | 29974 |
RRID | AB_3669501 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NQ94 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
A1CF, also known as Apobec-1 complementation factor, is an RNA-binding protein that plays a crucial role in the post-transcriptional editing of apolipoprotein B (apoB) mRNA. It is a component of the enzyme complex responsible for converting a CAA codon for glutamine to a UAA stop codon in apoB mRNA, resulting in the production of a truncated protein, apoB48, instead of the full-length apoB100.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for A1CF antibody 25812-1-AP | Download protocol |
IHC protocol for A1CF antibody 25812-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |