Tested Applications
| Positive WB detected in | mouse liver tissue |
| Positive IHC detected in | mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25812-1-AP targets A1CF in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22929 Product name: Recombinant human A1CF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC054873 Sequence: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIR Predict reactive species |
| Full Name | APOBEC1 complementation factor |
| Calculated Molecular Weight | 594 aa, 65 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC054873 |
| Gene Symbol | A1CF |
| Gene ID (NCBI) | 29974 |
| RRID | AB_3669501 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NQ94 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
A1CF, also known as Apobec-1 complementation factor, is an RNA-binding protein that plays a crucial role in the post-transcriptional editing of apolipoprotein B (apoB) mRNA. It is a component of the enzyme complex responsible for converting a CAA codon for glutamine to a UAA stop codon in apoB mRNA, resulting in the production of a truncated protein, apoB48, instead of the full-length apoB100.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for A1CF antibody 25812-1-AP | Download protocol |
| WB protocol for A1CF antibody 25812-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The A1CF Polyclonal antibody (Cat# 25812-1-AP) has 1 total citation. It appears in International Immunopharmacology (2025), a study investigating how metformin attenuates sepsis-related liver injury by modulating DNA methylation and hydroxymethylation landscapes. The research field encompasses immunopharmacology, sepsis pathophysiology, hepatic injury, and epigenetic regulation. The antibody was used for Western blot analysis in rat samples.
| Species | Application | Title |
|---|---|---|
Int Immunopharmacol Metformin attenuated sepsis-related liver injury by modulating the DNA methylation and hydroxymethylation landscape |
