Tested Applications
Positive WB detected in | human saliva |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
27674-1-AP targets A2ML1 in WB, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25818 Product name: Recombinant human A2ML1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1375-1454 aa of BC112131 Sequence: FSPMEGTNQLLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYSDPCE Predict reactive species |
Full Name | alpha-2-macroglobulin-like 1 |
Calculated Molecular Weight | 1454 aa, 161 kDa |
Observed Molecular Weight | 161 kDa |
GenBank Accession Number | BC112131 |
Gene Symbol | A2ML1 |
Gene ID (NCBI) | 144568 |
RRID | AB_3085984 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | A8K2U0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
A2ML1 is a member of the alpha-macroglobulin superfamily. It is thought to be an N-glycosylated monomeric protein that acts as an inhibitor of several proteases. It has been shown to form covalent interactions with proteases, and has been reported as the p170 antigen recognized by autoantibodies in the autoimmune disease paraneoplastic pemphigus.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for A2ML1 antibody 27674-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |