ABCA3 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83018-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 83018-2-PBS against Human ABCA3 was performed. The affinity constant is 1.45 nM.

ABCA3 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 83018-2-PBS

Clone No.230194B8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

150 Kda mature form, ABC C transporter, ABC3, ABCA 3, ABC-C transporter

---

Product Information

83018-2-PBS targets ABCA3 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24749

  Product name: Recombinant human ABCA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1606-1704 aa of BC140895

  Sequence: GSGYSLRAKVQSEGQQEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR

• Full Name: ATP-binding cassette, sub-family A (ABC1), member 3
• GenBank Accession Number: BC140895
• Gene Symbol: ABCA3
• Gene ID (NCBI): 21
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99758
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.