Product Information
83018-2-PBS targets ABCA3 in Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag24749 Product name: Recombinant human ABCA3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1606-1704 aa of BC140895 Sequence: GSGYSLRAKVQSEGQQEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR Predict reactive species |
Full Name | ATP-binding cassette, sub-family A (ABC1), member 3 |
GenBank Accession Number | BC140895 |
Gene Symbol | ABCA3 |
Gene ID (NCBI) | 21 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q99758 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |