ABCA3 Recombinant monoclonal antibody, PBS Only

Name: ABCA3 Recombinant monoclonal antibody, PBS Only,
Brand: Proteintech

ABCA3 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 83018-2-PBS

Clone No. 230194B8

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

150 Kda mature form, ABC C transporter, ABC3, ABCA 3, ABC-C transporter

Formulation: PBS Only

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllAffinity

Affinity and Kinetic Characterization of 83018-2-PBS
Biolayer interferometry (BLl) kinetic assay of 83018-2-PBS against Human ABCA3 was performed. The affinity constant is 1.45 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ABCA3 in ?

83018-2-PBS targets ABCA3 in Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag24749 Product name: Recombinant human ABCA3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1606-1704 aa of BC140895 Sequence: GSGYSLRAKVQSEGQQEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR Predict reactive species
Full Name	ATP-binding cassette, sub-family A (ABC1), member 3
GenBank Accession Number	BC140895
Gene Symbol	ABCA3
Gene ID (NCBI)	21
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q99758
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.