Tested Applications
| Positive WB detected in | 37°C incubated A549 cells, 37°C incubated HepG2 cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 1 publications below |
Product Information
29261-1-AP targets MRP2 in WB, IHC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30944 Product name: Recombinant human ABCC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1470-1545 aa of BC136419 Sequence: ETDNLIQTTIQNEFAHCTVITIAHRLHTIMDSDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF Predict reactive species |
| Full Name | ATP-binding cassette, sub-family C (CFTR/MRP), member 2 |
| Calculated Molecular Weight | 1545 aa, 174 kDa |
| Observed Molecular Weight | 190-250 kDa |
| GenBank Accession Number | BC136419 |
| Gene Symbol | ABCC2 |
| Gene ID (NCBI) | 1244 |
| RRID | AB_3086108 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92887 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Multi-drug resistance protein 2 (MRP2), also known as ABCC2, is an ATP binding cassette (ABC) transporter responsible for biliary excretion of xenobiotics, endobiotics, and their metabolites. Deficiency in ABCC2 results in the clinical disorder Dubin-Johnson syndrome. MRP2 is found to be expressed in a variety of human cancers, and is associated with resistance of tumor cells to various anticancer drugs including cisplatin. The predicted molecular weight of MRP2 is 174 kDa, while mature MRP2 usually has a slower migration around 190-250 kDa due to the glycosylation. (16434545, 18834541, 23045960)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MRP2 antibody 29261-1-AP | Download protocol |
| WB protocol for MRP2 antibody 29261-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Biol Sci BAP31-ELAVL1-SPINK6 axis induces loss of cell polarity and promotes metastasis in hepatocellular carcinoma | ||
Front Pharmacol A strategy for evaluating the impact of processing of Chinese meteria medica on meridian tropism: the influence of salt-water processing of phellodendri chinensis cortex on renal transport proteins | ||
J Ethnopharmacol Cortex Dictamni induces cholestatic liver injury via the bile acid-gut-liver axis mediated by FXR signaling pathway in rats |





