Tested Applications
| Positive WB detected in | 37°C incubated HeLa cells |
| Positive IHC detected in | human colon tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
25358-1-AP targets MRP3/ABCC3 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19786 Product name: Recombinant human ABCC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 838-960 aa of BC137348 Sequence: LLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFW Predict reactive species |
| Full Name | ATP-binding cassette, sub-family C (CFTR/MRP), member 3 |
| Calculated Molecular Weight | 1527 aa, 169 kDa |
| Observed Molecular Weight | 170-180 kDa |
| GenBank Accession Number | BC137348 |
| Gene Symbol | MRP3 |
| Gene ID (NCBI) | 8714 |
| RRID | AB_3085789 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15438 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MRP3 also known as ABCC3, belongs to ATP-binding cassette (ABC) transporter protein superfamily. MRP3 hydrolyzes ATP to enable active transport of various substrates including many drugs, toxicants, and endogenous compounds across cell membranes (PMID: 11581266, 15083066). In normal liver, MRP3 was found present mainly in the bile ducts. In livers of patients with various forms of cholestasis, MRP3 levels were frequently increased in the proliferative cholangiocytes, suggesting its role in cholehepatic and enterohepatic bile circulation and in protecting liver from toxic bile salts( PMID: 11850532, 11283840). MRP3 is expressed in the liver, colon, pancreas, and, at a lower level, in the kidney (PMID:10094960). For optimal WB detection of this membrane protein, we recommend to avoid boiling the sample after lysis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MRP3/ABCC3 antibody 25358-1-AP | Download protocol |
| WB protocol for MRP3/ABCC3 antibody 25358-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Life Sci SMARCA4 (BRG1) activates ABCC3 transcription to promote hepatocellular carcinogenesis | ||
Biomaterials Microfluidic fabricated cell-laden microgels aggregated into artificial liver microtissue to ameliorate drug-induced liver injury |







