ABCC5 Monoclonal antibody, PBS Only

ABCC5 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 67955-1-PBS
Clone No.2H10F11

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat

Applications

WB, Indirect ELISA

ABC33, ABCC5, DKFZp686C1782, EST277145, MOAT C, MOATC, MRP5, pABC11, SMRP

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67955-1-PBS targets ABCC5 in WB, Indirect ELISA applications and shows reactivity with Human, Rat samples.

Tested Reactivity Human, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag31674

Product name: Recombinant human ABCC5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-179 aa of NM_005688

Sequence: MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRL

Predict reactive species
Full Name ATP-binding cassette, sub-family C (CFTR/MRP), member 5
Calculated Molecular Weight 161 kDa
Observed Molecular Weight180-200kDa
GenBank Accession NumberNM_005688
Gene Symbol ABCC5
Gene ID (NCBI) 10057
RRIDAB_2918706
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO15440
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ABCC5, also named as MOAT-C, pABC11, SMRP, and MRP5, belongs to the ABC transporter superfamily, ABCC family, and Conjugate transporter (TC 3.A.1.208) subfamily. ABCC5 acts as a multispecific organic anion pump that can transport nucleotide analogs. ABCC5 functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that ABCC5 provides resistance to thiopurine anticancer drugs, 6-mercatopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl) adenine. ABCC5 may be involved in resistance to thiopurines in acute lymphoblastic leukemia and antiretroviral nucleoside analogs in HIV-infected patients. Since it is glycosylated, the apparent molecular weight of ABCC5 could be variable, ranging from 161 kDa to 200 kDa (PMID: 10893247; PMID: 15897250; PMID: 31338999).

Loading...
||
New chat

Able

正在加载,请稍候...