ABCD1 Recombinant monoclonal antibody

• 

  WB analysis of HeLa using 83038-4-RR

  WB result of ABCD1 antibody (83038-4-RR; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ABCD1 transfected HeLa cells.

• 

  WB analysis using 83038-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83038-4-RR (ABCD1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 83038-4-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ABCD1 antibody (83038-4-RR, Clone: 230226E12 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  FC experiment of HeLa using 83038-4-RR

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug ABCD1 Recombinant antibody (83038-4-RR, Clone:230226E12) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 83038-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83038-4-RR against Human ABCD1 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

ABCD1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 83038-4-RR

Clone No.230226E12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

230226E12, ABCD 1, ALD, ATP binding cassette sub family D member 1, ATP-binding cassette sub-family D member 1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, JAR cells, mouse liver tissue
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83038-4-RR targets ABCD1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0453

  Product name: Recombinant human ABCD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 334-507 aa of BC025358

  Sequence: LMKYVWSASGLLMVAVPIITATGYSESDAEAVKKAALEKKEEELVSERTEAFTIARNLLTAAADAIERIMSSYKEVTELAGYTARVHEMFQVFEDVQRCHFKRPRELEDAQAGSGTIGRSGVRVEGPLKIRGQVVDVEQGIICENIPIVTPSGEVVVASLNIRVEEGMHLLITG

• Full Name: ATP-binding cassette, sub-family D (ALD), member 1
• Calculated Molecular Weight: 745 aa, 83 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC025358
• Gene Symbol: ABCD1
• Gene ID (NCBI): 215
• RRID: AB_3670769
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P33897
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ABCD1 (also known as ALDP) is a member of the ATP-binding cassette (ABC) transporter superfamily which functions as transporter for a wide variety of substrates. It localizes to the peroxisomal membrane. The exact function is not clear so far. Various mutations of ABCD1 cause X-linked adrenoleukodystrophy (X-ALD), an inherited neurodegenerative disease affecting the nervous system white matter and adrenal cortex.