• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated ABCD1 Recombinant monoclonal antibody

ABCD1 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-83038-4
Clone No.230226E12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

230226E12, ABCD 1, ALD, ATP binding cassette sub family D member 1, ATP-binding cassette sub-family D member 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83038-4 targets ABCD1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0453

Product name: Recombinant human ABCD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 334-507 aa of BC025358

Sequence: LMKYVWSASGLLMVAVPIITATGYSESDAEAVKKAALEKKEEELVSERTEAFTIARNLLTAAADAIERIMSSYKEVTELAGYTARVHEMFQVFEDVQRCHFKRPRELEDAQAGSGTIGRSGVRVEGPLKIRGQVVDVEQGIICENIPIVTPSGEVVVASLNIRVEEGMHLLITG

Predict reactive species
Full Name ATP-binding cassette, sub-family D (ALD), member 1
Calculated Molecular Weight 745 aa, 83 kDa
Observed Molecular Weight 75 kDa
GenBank Accession NumberBC025358
Gene Symbol ABCD1
Gene ID (NCBI) 215
RRIDAB_3673174
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP33897
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ABCD1 (also known as ALDP) is a member of the ATP-binding cassette (ABC) transporter superfamily which functions as transporter for a wide variety of substrates. It localizes to the peroxisomal membrane. The exact function is not clear so far. Various mutations of ABCD1 cause X-linked adrenoleukodystrophy (X-ALD), an inherited neurodegenerative disease affecting the nervous system white matter and adrenal cortex.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 ABCD1 antibody CL488-83038-4Download protocol
IF protocol for CL Plus 488 ABCD1 antibody CL488-83038-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...