• Featured Product
  • KD/KO Validated

ABCD1 Recombinant monoclonal antibody, PBS Only

ABCD1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 83038-4-PBS
Clone No.230226E12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

EC:3.1.2.-, ATP-binding cassette sub-family D member 1, ATP binding cassette sub family D member 1, ALD, ABCD 1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83038-4-PBS targets ABCD1 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0453

Product name: Recombinant human ABCD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 334-507 aa of BC025358

Sequence: LMKYVWSASGLLMVAVPIITATGYSESDAEAVKKAALEKKEEELVSERTEAFTIARNLLTAAADAIERIMSSYKEVTELAGYTARVHEMFQVFEDVQRCHFKRPRELEDAQAGSGTIGRSGVRVEGPLKIRGQVVDVEQGIICENIPIVTPSGEVVVASLNIRVEEGMHLLITG

Predict reactive species
Full Name ATP-binding cassette, sub-family D (ALD), member 1
Calculated Molecular Weight 745 aa, 83 kDa
Observed Molecular Weight 75 kDa
GenBank Accession NumberBC025358
Gene Symbol ABCD1
Gene ID (NCBI) 215
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP33897
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ABCD1 (also known as ALDP) is a member of the ATP-binding cassette (ABC) transporter superfamily which functions as transporter for a wide variety of substrates. It localizes to the peroxisomal membrane. The exact function is not clear so far. Various mutations of ABCD1 cause X-linked adrenoleukodystrophy (X-ALD), an inherited neurodegenerative disease affecting the nervous system white matter and adrenal cortex.

Loading...
||
New chat Able
正在加载,请稍候...