ABCE1 Polyclonal antibody

• 

  IHC staining of human ovary using 51008-2-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 51008-2-AP (ABCE1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary using 51008-2-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 51008-2-AP (ABCE1 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human ovary using 51008-2-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 51008-2-AP (ABCE1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary using 51008-2-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 51008-2-AP (ABCE1 antibody) at dilution of 1:50 (under 40x lens).

ABCE1 Polyclonal Antibody for ELISA

Cat No. 51008-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

---

Product Information

51008-2-AP targets ABCE1 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0454

  Product name: Recombinant human ABCE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-119 aa of BC016283

  Sequence: MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA

• Full Name: ATP-binding cassette, sub-family E (OABP), member 1
• Calculated Molecular Weight: 599 aa, 67 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC016283
• Gene Symbol: ABCE1
• Gene ID (NCBI): 6059
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61221
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.