ABHD14B Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87389-1-RR (same clone as 87389-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87389-1-RR (ABHD14B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87389-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87389-1-RR (same clone as 87389-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87389-1-RR (ABHD14B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87389-1-PBS in a different storage buffer formulation.

ABHD14B Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87389-1-PBS

Clone No.252778C8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Abhydrolase domain-containing protein 14B, Alpha/beta hydrolase domain-containing protein 14B, CCG1-interacting factor B, CIB, EC:2.3.1.-

---

Product Information

87389-1-PBS targets ABHD14B in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15097

  Product name: Recombinant human ABHD14B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-210 aa of BC007234

  Sequence: MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ

• Full Name: abhydrolase domain containing 14B
• Calculated Molecular Weight: 210 aa, 22 kDa
• Observed Molecular Weight: 20-30 kDa
• GenBank Accession Number: BC007234
• Gene Symbol: ABHD14B
• Gene ID (NCBI): 84836
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96IU4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ABHD14B possessed the canonical ABHD fold, an invariant catalytic triad (Ser-His-Asp), and based on its protein sequence, was subsequently categorized as an outlying member of the metabolic serine hydrolase family. ABHD14B was able to transfer an acetyl group from post translationally modified protein lysine residue to coenzyme-A (CoA), thus making the biologically important acetyl-CoA.