Featured Product
KD/KO Validated

ABI1 Polyclonal antibody

ABI1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27387-1-AP

Publications (4)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

Abelson interactor 1, ABI 1, Abi-1, Abl-binding protein 4, Eps8 SH3 domain-binding protein

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 27387-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 27387-1-AP (ABI1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 27387-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 27387-1-AP (ABI1 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293T using 27387-1-AP
HEK-293T cells were subjected to SDS PAGE followed by western blot with 27387-1-AP (ABI1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of C2C12 using 27387-1-AP
C2C12 cell were subjected to SDS PAGE followed by western blot with 27387-1-AP (ABI1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of MCF-7 using 27387-1-AP
MCF-7 cells were subjected to SDS PAGE followed by western blot with 27387-1-AP (ABI1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse skin using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse skin using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse ovary using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat brain using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat stomach using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse ovary using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse stomach using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat brain using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat stomach using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ABI1 in ?

Overview

Tested Applications
Product Information
Publications (4)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	Neuro-2a cells, C2C12 cells, multi cells, HEK-293T cells, HepG2 cells, HEK 293 cells, Jurkat cells, mouse cerebellum tissue, rat cerebellum tissue
Positive IHC detected in	mouse skin tissue, rat stomach tissue, mouse stomach tissue, mouse brain tissue, human ovary cancer tissue, rat brain tissue, mouse ovary tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27387-1-AP targets ABI1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26537 Product name: Recombinant human ABI1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 265-379 aa of BC024254 Sequence: TIGPAAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSP Predict reactive species
Full Name	abl-interactor 1
Calculated Molecular Weight	507 aa, 55 kDa
Observed Molecular Weight	55-60 kDa
GenBank Accession Number	BC024254
Gene Symbol	ABI1
Gene ID (NCBI)	10006
RRID	AB_2880860
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8IZP0
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for ABI1 antibody 27387-1-AP	Download protocol
WB protocol for ABI1 antibody 27387-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-ABI1 (affinity purified), catalog number 27387-1-AP, has 4 total citations published in Nature Communications, Journal of Ovarian Res, Translational Oncology, and Journal of Psychiatric Research. The associated research fields include bacterial infection and cell-to-cell spread, ovarian cancer, colorectal cancer (ERK signaling), and schizophrenia-related neurite development. Applications cited span IF, WB, and CoIP in human samples.

Species	Application	Title
human	IF	Nat Commun A pore-forming toxin initiates ABI1 complex switching to promote bacterial cell-to-cell spread. Authors - He Sun KO Validated View Article
human	WB	J Ovarian Res Modified screening of MYC promotor region elements using the CRISPR library in ovarian cancer Authors - Akiko Yamamoto View Article
human	WB,IF,CoIP	Transl Oncol CBLC promotes the development of colorectal cancer by promoting ABI1 degradation to activate the ERK signaling pathway Authors - Zhan Li View Article
human	WB	J Psychiatr Res Circulating miR-30e-3p induces disruption of neurite development in SH-SY5Y cells by targeting ABI1, a novel biomarker for schizophrenia Authors - Mengdi Jin KD Validated View Article