ABI1 Polyclonal antibody

• 

  WB analysis using 27387-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27387-1-AP (ABI1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27387-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27387-1-AP (ABI1 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293T using 27387-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 27387-1-AP (ABI1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of C2C12 using 27387-1-AP

  C2C12 cell were subjected to SDS PAGE followed by western blot with 27387-1-AP (ABI1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 27387-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 27387-1-AP (ABI1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skin using 27387-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 27387-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 27387-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 27387-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

ABI1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27387-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

Abelson interactor 1, ABI 1, ABI1, Abl binding protein 4, abl interactor 1, AblBP4, E3B1, Eps8 binding protein, Nap1 binding protein, NAP1BP, SSH3BP, SSH3BP1

---

Tested Applications

• Positive WB detected in: Neuro-2a cells, C2C12 cells, multi cells, HEK-293T cells, HepG2 cells, HEK 293 cells, Jurkat cells, mouse cerebellum tissue, rat cerebellum tissue
• Positive IHC detected in: mouse skin tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

27387-1-AP targets ABI1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26537

  Product name: Recombinant human ABI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 265-379 aa of BC024254

  Sequence: TIGPAAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSP

• Full Name: abl-interactor 1
• Calculated Molecular Weight: 507 aa, 55 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC024254
• Gene Symbol: ABI1
• Gene ID (NCBI): 10006
• RRID: AB_2880860
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IZP0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Ovarian Res; Modified screening of MYC promotor region elements using the CRISPR library in ovarian cancer; Authors - Akiko Yamamoto
human	WB	J Psychiatr Res; Circulating miR-30e-3p induces disruption of neurite development in SH-SY5Y cells by targeting ABI1, a novel biomarker for schizophrenia; Authors - Mengdi Jin ; KD Validated
human	WB,IF,CoIP	Transl Oncol; CBLC promotes the development of colorectal cancer by promoting ABI1 degradation to activate the ERK signaling pathway; Authors - Zhan Li