Filter: AllWBIHC

WB analysis using 27387-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 27387-1-AP (ABI1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
WB analysis using 27387-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 27387-1-AP (ABI1 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.
WB analysis of HEK-293T using 27387-1-AP
HEK-293T cells were subjected to SDS PAGE followed by western blot with 27387-1-AP (ABI1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
WB analysis of C2C12 using 27387-1-AP
C2C12 cell were subjected to SDS PAGE followed by western blot with 27387-1-AP (ABI1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of MCF-7 using 27387-1-AP
MCF-7 cells were subjected to SDS PAGE followed by western blot with 27387-1-AP (ABI1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
IHC staining of mouse skin using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse skin using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human ovary cancer using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse ovary using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat brain using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat stomach using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human ovary cancer using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse ovary using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse stomach using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat brain using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat stomach using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse brain using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse brain using 27387-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27387-1-AP (ABI1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Featured Product
KD/KO Validated

ABI1 Polyclonal antibody

ABI1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27387-1-AP

Publications(3)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

Abelson interactor 1, ABI 1, Abi-1, Abl-binding protein 4, Eps8 SH3 domain-binding protein

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (3)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	Neuro-2a cells, C2C12 cells, multi cells, HEK-293T cells, HepG2 cells, HEK 293 cells, Jurkat cells, mouse cerebellum tissue, rat cerebellum tissue
Positive IHC detected in	mouse skin tissue, mouse brain tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 1 publications below
WB	See 3 publications below
IF	See 1 publications below
CoIP	See 1 publications below

Product Information

27387-1-AP targets ABI1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26537 Product name: Recombinant human ABI1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 265-379 aa of BC024254 Sequence: TIGPAAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSP Predict reactive species
Full Name	abl-interactor 1
Calculated Molecular Weight	507 aa, 55 kDa
Observed Molecular Weight	55-60 kDa
GenBank Accession Number	BC024254
Gene Symbol	ABI1
Gene ID (NCBI)	10006
RRID	AB_2880860
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8IZP0
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for ABI1 antibody 27387-1-AP	Download protocol
WB protocol for ABI1 antibody 27387-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	J Ovarian Res Modified screening of MYC promotor region elements using the CRISPR library in ovarian cancer Authors - Akiko Yamamoto View Article
human	WB	J Psychiatr Res Circulating miR-30e-3p induces disruption of neurite development in SH-SY5Y cells by targeting ABI1, a novel biomarker for schizophrenia Authors - Mengdi Jin KD Validated View Article
human	WB,IF,CoIP	Transl Oncol CBLC promotes the development of colorectal cancer by promoting ABI1 degradation to activate the ERK signaling pathway Authors - Zhan Li View Article