Tested Applications
Positive WB detected in | Neuro-2a cells, C2C12 cells, multi cells, HEK-293T cells, HepG2 cells, HEK 293 cells, Jurkat cells, mouse cerebellum tissue, rat cerebellum tissue |
Positive IHC detected in | mouse skin tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 3 publications below |
IF | See 1 publications below |
CoIP | See 1 publications below |
Product Information
27387-1-AP targets ABI1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26537 Product name: Recombinant human ABI1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 265-379 aa of BC024254 Sequence: TIGPAAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSP Predict reactive species |
Full Name | abl-interactor 1 |
Calculated Molecular Weight | 507 aa, 55 kDa |
Observed Molecular Weight | 55-60 kDa |
GenBank Accession Number | BC024254 |
Gene Symbol | ABI1 |
Gene ID (NCBI) | 10006 |
RRID | AB_2880860 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8IZP0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ABI1 antibody 27387-1-AP | Download protocol |
IHC protocol for ABI1 antibody 27387-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Ovarian Res Modified screening of MYC promotor region elements using the CRISPR library in ovarian cancer | ||
J Psychiatr Res Circulating miR-30e-3p induces disruption of neurite development in SH-SY5Y cells by targeting ABI1, a novel biomarker for schizophrenia
| ||
Transl Oncol CBLC promotes the development of colorectal cancer by promoting ABI1 degradation to activate the ERK signaling pathway |