ABI3BP Polyclonal antibody, PBS Only

• 

  WB analysis using 27727-1-AP (same clone as 27727-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27727-1-AP (ABI3BP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27727-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 27727-1-AP (same clone as 27727-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 27727-1-AP (ABI3BP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27727-1-PBS in a different storage buffer formulation.

ABI3BP Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27727-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

27727-1-PBS targets ABI3BP in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26841

  Product name: Recombinant human ABI3BP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 221-419 aa of BC030221

  Sequence: GSKKVNGKIQSTYDQDHTVPAYVPRKLIPITIIKQVIQNVTHKDSAKSPEKAPLGGVILVHLIIPGLNETTVKLPASLMFEISDALKTQLAKNETLALPAESKTPEVEKISARPTTVTPETVPRSTKPTTSSALDVSETTLASSEKPWIVPTAKISEDSKVLQPQTATYDVFSSPTTSDEPEISDSYTATSDRILDSIP

• Full Name: ABI family, member 3 (NESH) binding protein
• Calculated Molecular Weight: 119 kDa
• Observed Molecular Weight: 54 kDa, 72 kDa
• GenBank Accession Number: BC030221
• Gene Symbol: ABI3BP
• Gene ID (NCBI): 25890
• RRID: AB_2880955
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z7G0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.