ABI3BP Polyclonal antibody

• 

  WB analysis using 27727-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27727-1-AP (ABI3BP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 27727-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 27727-1-AP (ABI3BP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

ABI3BP Polyclonal Antibody for WB, ELISA

Cat No. 27727-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse

Applications

WB, ELISA

Synonyms

ABI3BP, Nesh binding protein, NESHBP, Target of Nesh SH3, TARSH

---

Tested Applications

• Positive WB detected in: C2C12 cell, mouse thymus tissue, C2C12 cells, mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27727-1-AP targets ABI3BP in WB, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26841

  Product name: Recombinant human ABI3BP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 221-419 aa of BC030221

  Sequence: GSKKVNGKIQSTYDQDHTVPAYVPRKLIPITIIKQVIQNVTHKDSAKSPEKAPLGGVILVHLIIPGLNETTVKLPASLMFEISDALKTQLAKNETLALPAESKTPEVEKISARPTTVTPETVPRSTKPTTSSALDVSETTLASSEKPWIVPTAKISEDSKVLQPQTATYDVFSSPTTSDEPEISDSYTATSDRILDSIP

• Full Name: ABI family, member 3 (NESH) binding protein
• Calculated Molecular Weight: 119 kDa
• Observed Molecular Weight: 54 kDa, 72 kDa
• GenBank Accession Number: BC030221
• Gene Symbol: ABI3BP
• Gene ID (NCBI): 25890
• RRID: AB_2880955
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z7G0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.