Tested Applications
| Positive WB detected in | HEK-293T cells, HeLa cells, Jurkat cells, LNCaP cells |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
32207-1-AP targets ABL1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26145 Product name: Recombinant human ABL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 801-900 aa of NM_005157 Sequence: MIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP Predict reactive species |
| Full Name | c-abl oncogene 1, receptor tyrosine kinase |
| Calculated Molecular Weight | 123 kDa |
| Observed Molecular Weight | 120-130 kDa |
| GenBank Accession Number | NM_005157 |
| Gene Symbol | ABL1 |
| Gene ID (NCBI) | 25 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P00519 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ABL1, also named as ABL, JTK7, c-ABL and p150, belongs to the protein kinase superfamily, Tyr protein kinase family and ABL subfamily. ABL1 regulates cytoskeleton remodeling during cell differentiation, cell division and cell adhesion. ABL1 localizes to dynamic actin structures, and phosphorylates CRK and CRKL, DOK1, and other proteins controlling cytoskeleton dynamics. It regulates DNA repair potentially by activating the proapoptotic pathway when the DNA damage is too severe to be repaired. ABL1 catalyze the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. A chromosomal aberration involving ABL1 is a cause of chronic myeloid leukemia (CML) [MIM:608232]. Translocation t(9;22)(q34;q11) with BCR. The translocation produces a BCR-ABL found also in acute myeloid leukemia (AML) and acute lymphoblastic leukemia (ALL).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ABL1 antibody 32207-1-AP | Download protocol |
| WB protocol for ABL1 antibody 32207-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



