Tested Applications
Positive WB detected in | mouse brain tissue, mouse skeletal muscle tissue |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | mouse skeletal muscle tissue, human skeletal muscle tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
22433-1-AP targets ABLIM2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18198 Product name: Recombinant human ABLIM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 282-389 aa of BC122567 Sequence: SIISVPASSTSGSPSRVIYAKLGGEILDYRDLAALPKSKAIYDIDRPDMISYSPYISHSAGDRQSYGEGDQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRP Predict reactive species |
Full Name | actin binding LIM protein family, member 2 |
Calculated Molecular Weight | 611 aa, 68 kDa |
Observed Molecular Weight | 60-70 kDa |
GenBank Accession Number | BC122567 |
Gene Symbol | ABLIM2 |
Gene ID (NCBI) | 84448 |
RRID | AB_11232422 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6H8Q1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ABLIM2 antibody 22433-1-AP | Download protocol |
IHC protocol for ABLIM2 antibody 22433-1-AP | Download protocol |
IP protocol for ABLIM2 antibody 22433-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Joleen (Verified Customer) (06-10-2019) | Cell lysate on the left lane expressed GFP-ABLIM2 while on the right lane was wildtype cells. Antibody recognizes the GFP tagged construct ABLIM2 really well.
![]() |