Tested Applications
| Positive WB detected in | mouse brain tissue, mouse skeletal muscle tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse skeletal muscle tissue, human skeletal muscle tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22433-1-AP targets ABLIM2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18198 Product name: Recombinant human ABLIM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 282-389 aa of BC122567 Sequence: SIISVPASSTSGSPSRVIYAKLGGEILDYRDLAALPKSKAIYDIDRPDMISYSPYISHSAGDRQSYGEGDQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRP Predict reactive species |
| Full Name | actin binding LIM protein family, member 2 |
| Calculated Molecular Weight | 611 aa, 68 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC122567 |
| Gene Symbol | ABLIM2 |
| Gene ID (NCBI) | 84448 |
| RRID | AB_11232422 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6H8Q1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ABLIM2 antibody 22433-1-AP | Download protocol |
| IP protocol for ABLIM2 antibody 22433-1-AP | Download protocol |
| WB protocol for ABLIM2 antibody 22433-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
One reviewer (Joleen Cheah, June 2019) gave this antibody a 5-star rating after using it in Western Blot at a 1:1,000 dilution on MDCK GII cells. She reported that the antibody recognized a GFP-tagged ABLIM2 construct very well, with clear specificity compared to wildtype cell lysate controls. Overall, the review reflects strong performance and reliable detection of the target protein.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Joleen (Verified Customer) (06-10-2019) | Cell lysate on the left lane expressed GFP-ABLIM2 while on the right lane was wildtype cells. Antibody recognizes the GFP tagged construct ABLIM2 really well.
 |
