ABLIM2 Polyclonal antibody

• 

  WB analysis of mouse brain using 22433-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22433-1-AP (ABLIM2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 22433-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 22433-1-AP (ABLIM2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 22433-1-AP

  IP result of anti-ABLIM2 (IP:22433-1-AP, 4ug; Detection:22433-1-AP 1:1000) with mouse brain tissue lysate 1280 ug.

• 

  IHC staining of mouse skeletal muscle using 22433-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 22433-1-AP (ABLIM2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 22433-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 22433-1-AP (ABLIM2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skeletal muscle using 22433-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 22433-1-AP (ABLIM2 Antibody) at dilution of 1:50.

• 

  IHC staining of human skeletal muscle using 22433-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 22433-1-AP (ABLIM2 Antibody) at dilution of 1:50.

• 

  IHC staining of human kidney using 22433-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney slide using 22433-1-AP (ABLIM2 Antibody) at dilution of 1:50.

• 

  IHC staining of human kidney using 22433-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney slide using 22433-1-AP (ABLIM2 Antibody) at dilution of 1:50.

ABLIM2 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 22433-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

Synonyms

abLIM 2, ABLIM2, Actin binding LIM protein 2, KIAA1808

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse skeletal muscle tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse skeletal muscle tissue, human skeletal muscle tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22433-1-AP targets ABLIM2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18198

  Product name: Recombinant human ABLIM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 282-389 aa of BC122567

  Sequence: SIISVPASSTSGSPSRVIYAKLGGEILDYRDLAALPKSKAIYDIDRPDMISYSPYISHSAGDRQSYGEGDQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRP

• Full Name: actin binding LIM protein family, member 2
• Calculated Molecular Weight: 611 aa, 68 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC122567
• Gene Symbol: ABLIM2
• Gene ID (NCBI): 84448
• RRID: AB_11232422
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6H8Q1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Joleen (Verified Customer) (06-10-2019)

Cell lysate on the left lane expressed GFP-ABLIM2 while on the right lane was wildtype cells. Antibody recognizes the GFP tagged construct ABLIM2 really well.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1k
• Cell Tissue Type: MDCK GII

ABLIM2 Antibody Western Blot, validation (1:1k dilution) in MDCK GII (Cat no:22433-1-AP)