Use Able AI chat for product recommendations

ABLIM2 Polyclonal antibody

ABLIM2 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 22433-1-AP
Reviews (1)
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

abLIM 2, ABLIM2, Actin binding LIM protein 2, KIAA1808

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ABLIM2 in ?

Tested Applications

Positive WB detected inmouse brain tissue, mouse skeletal muscle tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse skeletal muscle tissue, human skeletal muscle tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22433-1-AP targets ABLIM2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18198

Product name: Recombinant human ABLIM2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 282-389 aa of BC122567

Sequence: SIISVPASSTSGSPSRVIYAKLGGEILDYRDLAALPKSKAIYDIDRPDMISYSPYISHSAGDRQSYGEGDQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRP

Predict reactive species
Full Name actin binding LIM protein family, member 2
Calculated Molecular Weight 611 aa, 68 kDa
Observed Molecular Weight 60-70 kDa
GenBank Accession NumberBC122567
Gene Symbol ABLIM2
Gene ID (NCBI) 84448
RRIDAB_11232422
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6H8Q1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for ABLIM2 antibody 22433-1-APDownload protocol
IP protocol for ABLIM2 antibody 22433-1-APDownload protocol
WB protocol for ABLIM2 antibody 22433-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Joleen Cheah, June 2019) gave this antibody a 5-star rating after using it in Western Blot at a 1:1,000 dilution on MDCK GII cells. She reported that the antibody recognized a GFP-tagged ABLIM2 construct very well, with clear specificity compared to wildtype cell lysate controls. Overall, the review reflects strong performance and reliable detection of the target protein.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Joleen (Verified Customer) (06-10-2019)

Cell lysate on the left lane expressed GFP-ABLIM2 while on the right lane was wildtype cells. Antibody recognizes the GFP tagged construct ABLIM2 really well.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1k
  • Cell Tissue Type: MDCK GII
ABLIM2 Antibody Western Blot, validation (1:1k dilution) in MDCK GII (Cat no:22433-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...