Product Information
84011-3-PBS targets ABR in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag29522 Product name: Recombinant human ABR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of NM_021962 Sequence: MEPLSHRGLPRLSWIDTLYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK Predict reactive species |
Full Name | active BCR-related gene |
Calculated Molecular Weight | 98 kDa |
GenBank Accession Number | NM_021962 |
Gene Symbol | ABR |
Gene ID (NCBI) | 29 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q12979 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |