Product Information
82967-4-PBS targets ACAP1 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag34309 Product name: Recombinant human ACAP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 163-270 aa of BC018543 Sequence: RAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEG Predict reactive species |
Full Name | ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 |
Calculated Molecular Weight | 740 aa, 82 kDa |
Observed Molecular Weight | 82-85 kDa |
GenBank Accession Number | BC018543 |
Gene Symbol | ACAP1 |
Gene ID (NCBI) | 9744 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q15027 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
ACAP1, also named as Centaurin-beta-1, is a 740 amino acid protein, which is expressed Highly in lung and spleen. ACAP1 as a GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6) is required for clathrin-dependent export of proteins from recycling endosomes to trans-Golgi network and cell surface and required for regulated export of ITGB1 from recycling endosomes to the cell surface and ITGB1-dependent cell migration.