ACC1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67373-1-Ig (same clone as 67373-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67373-1-Ig (ACC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67373-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67373-1-Ig (same clone as 67373-1-PBS)

  WB result of ACC1 antibody (67373-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ACC1 transfected HeLa cells. This data was developed using the same antibody clone with 67373-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67373-1-Ig (same clone as 67373-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67373-1-Ig (ACC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67373-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67373-1-Ig (same clone as 67373-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67373-1-Ig (ACC1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67373-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67373-1-Ig (same clone as 67373-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67373-1-Ig (ACC1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67373-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67373-1-Ig (same clone as 67373-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ACC1 antibody (67373-1-Ig, Clone: 1A11G10 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 67373-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ACC1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67373-1-PBS

Clone No.1A11G10

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ACACA, ACC-alpha, ACCA, ACC, ACAC

---

Product Information

67373-1-PBS targets ACC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17503

  Product name: Recombinant human ACC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 2260-2383 aa of BC137287

  Sequence: LLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST

• Full Name: acetyl-Coenzyme A carboxylase alpha
• Calculated Molecular Weight: 2383 aa, 275 kDa
• Observed Molecular Weight: 250-270 kDa
• GenBank Accession Number: BC137287
• Gene Symbol: Acetyl-CoA Carboxylase 1
• Gene ID (NCBI): 31
• RRID: AB_2882621
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13085
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ACACA(Acetyl-CoA carboxylase 1, ACC), also named as ACAC, ACC1 and ACCA, belongs to the biotin containing enzyme family. It catalyzes the synthesis of malonyl-CoA, which is an intermediate substrate playing a pivotal role in the regulation of fatty acid metabolism and energy production. ACACA is involved in the biosynthesis of fatty acids, and malonyl-CoA produced is used as a building block to extend the chain length of fatty acids by fatty acid synthase (FAS)(PMID:19900410). It has 4 isoforms produced by alternative promoter usage with the molecular weight between 260 kDa and 270 kDa.