Tested Applications
| Positive WB detected in | HeLa cells, NIH/3T3 cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:10000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67373-1-Ig targets ACC1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, hamster, goat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17503 Product name: Recombinant human ACC protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 2260-2383 aa of BC137287 Sequence: LLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST Predict reactive species |
| Full Name | acetyl-Coenzyme A carboxylase alpha |
| Calculated Molecular Weight | 2383 aa, 275 kDa |
| Observed Molecular Weight | 250-270 kDa |
| GenBank Accession Number | BC137287 |
| Gene Symbol | Acetyl-CoA Carboxylase 1 |
| Gene ID (NCBI) | 31 |
| RRID | AB_2882621 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13085 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ACACA(Acetyl-CoA carboxylase 1, ACC), also named as ACAC, ACC1 and ACCA, belongs to the biotin containing enzyme family. It catalyzes the synthesis of malonyl-CoA, which is an intermediate substrate playing a pivotal role in the regulation of fatty acid metabolism and energy production. ACACA is involved in the biosynthesis of fatty acids, and malonyl-CoA produced is used as a building block to extend the chain length of fatty acids by fatty acid synthase (FAS)(PMID:19900410). It has 4 isoforms produced by alternative promoter usage with the molecular weight between 260 kDa and 270 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for ACC1 antibody 67373-1-Ig | Download protocol |
| IF protocol for ACC1 antibody 67373-1-Ig | Download protocol |
| IHC protocol for ACC1 antibody 67373-1-Ig | Download protocol |
| WB protocol for ACC1 antibody 67373-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ACC1 Monoclonal antibody (Cat# 67373-1-Ig) has 64 citations published in over 50 journals, including Nature, Cell Metabolism, Nature Communications, EMBO Journal, Cell Death & Differentiation, Theranostics, and Advanced Science. Key research fields include lipid and fatty acid metabolism, cholesterol biosynthesis, liver diseases (NAFLD/MASH), cancer (colorectal, ovarian, glioma, bladder), ferroptosis, cardiovascular disease, diabetes, obesity, and autophagy. Applications are predominantly Western blot, supplemented by IHC and IF, across mouse, human, rat, and other species.
| Species | Application | Title |
|---|---|---|
Cell Metab Myeloid beta-arrestin 2 depletion attenuates metabolic dysfunction-associated steatohepatitis via the metabolic reprogramming of macrophages | ||
Autophagy Periplocin suppresses the growth of colorectal cancer cells by triggering LGALS3 (galectin 3)-mediated lysophagy | ||
Reviews
What customers say
Both reviewers rated the antibody 5 stars. One user found it effective for immunofluorescence, while the other successfully used it at a 1:1000 dilution for Western Blot on Caco2 cells and mouse colon tissue. Overall, customers report positive results across different applications and sample types.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Parijat (Verified Customer) (09-09-2023) | Goof antibody
|
Priya (Verified Customer) (06-21-2023) | Used this antibody for Caco2 cells and mice tissue
|
