Tested Applications
| Positive WB detected in | mouse kidney tissue, human skeletal muscle tissue |
| Positive IP detected in | mouse kidney tissue |
| Positive IHC detected in | human kidney tissue, human small intestine tissue, human kidney tissue, mouse kidney tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human kidney tissue, mouse kidney tissue |
| Positive IF-Fro detected in | mouse kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21115-1-AP targets ACE2 in WB, IHC, IF-P, IF-Fro, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, canine, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15455 Product name: Recombinant human ACE2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 392-744 aa of BC048094 Sequence: LRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLI Predict reactive species |
| Full Name | angiotensin I converting enzyme (peptidyl-dipeptidase A) 2 |
| Calculated Molecular Weight | 805 aa, 92 kDa |
| Observed Molecular Weight | 120 kDa, 92 kDa |
| GenBank Accession Number | BC048094 |
| Gene Symbol | ACE2 |
| Gene ID (NCBI) | 59272 |
| RRID | AB_10732845 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BYF1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ACE2 (Angiotensin-converting enzyme 2), also named as ACEH, is a zinc metalloprotease of the ACE family and a critical regulator of the reninangiotensin system. ACE2 has a more restricted tissue distribution than ACE, being found predominantly in the heart, kidneys, and testes although low levels have been detected in a variety of tissues (PMID:15983030). ACE2 has been shown to be a functional receptor of the human coronaviruses SARS-CoV and SARS-CoV-2 (PMID: 32142651). The expression level and expression pattern of human ACE2 in different tissues might be critical for the susceptibility, symptoms, and outcome of 2019-nCoV/SARS-CoV-2 infection (PMID: 32133153). It can be used as a potential therapeutic target of SARS-CoV-2 (PMID: 32125455). The calculated molecular weight of ACE2 is 92kDa but it migrates to 120kDa due to N-glycosylation (PMID:16166094). Sometimes, several cleaved fragments can also be detected as 75kDa, 50 kDa or 37kDa (PMID: 29561187, 22009550, 30759273). It has 2 isoforms produced by alternative splicing. This antibody is specific to ACE2. The location of ACE2 is membrane and cytoplasm, however it accumulates in the nucleus during the mitosis (PMID: 1730413/PMID: 18292088).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ACE2 antibody 21115-1-AP | Download protocol |
| IHC protocol for ACE2 antibody 21115-1-AP | Download protocol |
| IP protocol for ACE2 antibody 21115-1-AP | Download protocol |
| WB protocol for ACE2 antibody 21115-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-ACE2 antibody (Cat# 21115-1-AP) has accumulated 168 citations across 80+ journals, including high-impact publications such as Nature Communications, Nature Genetics, Nature Metabolism, Cell Reports, Science Bulletin, and eLife. The associated research fields primarily encompass SARS-CoV-2/COVID-19 virology, renin-angiotensin system biology, cardiovascular disease, pulmonary pathology, immunology, neuroscience, nephrology, and oncology. Common applications include WB, IF, IHC, IP, and CoIP in human, mouse, rat, and monkey models.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells. | ||
Signal Transduct Target Ther Asialoglycoprotein receptor 1 promotes SARS-CoV-2 infection of human normal hepatocytes | ||
Cell Res Receptome profiling identifies KREMEN1 and ASGR1 as alternative functional receptors of SARS-CoV-2. | ||
Nat Genet Bidirectional genome-wide CRISPR screens reveal host factors regulating SARS-CoV-2, MERS-CoV and seasonal HCoVs | ||
Eur Respir J Influenza virus infection increases ACE2 expression and shedding in human small airway epithelial cells. |
Reviews
What customers say
Users report positive experiences with this antibody across multiple applications. One reviewer found it performed well in Western Blot at 1:1000 dilution on D407 cells, noting slightly more non-specific bands compared to the monoclonal version but still easy to interpret. Another user was satisfied with its performance in dot-blot and immunofluorescence at 1:200 dilution using an Alexa Fluor 555 secondary antibody. A third reviewer simply rated it "Good" for Western Blot. Overall, users rate it favorably for WB and IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Alexandra (Verified Customer) (08-28-2026) | This AB worked well with our Wester Blots. It definetly has more unspecific bands than the monoclonal one, but it is still easy to identify the correct one.
|
Magdalena (Verified Customer) (07-18-2022) | I'm satisfied with this antibody. I used this antibody in dot-blot technique and IF. In IF I used dilution factor 1:200, seconday antibody was alexa fluor 555.
|
Ratna (Verified Customer) (01-14-2021) | Good
|
