Tested Applications
Positive WB detected in | mouse brain tissue, 4T1 cells |
Positive IHC detected in | human breast cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IF | See 1 publications below |
Product Information
22214-1-AP targets ACP1 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17539 Product name: Recombinant human ACP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 15-102 aa of BC007422 Sequence: GNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNR Predict reactive species |
Full Name | acid phosphatase 1, soluble |
Calculated Molecular Weight | 158 aa, 18 kDa |
Observed Molecular Weight | 18 kDa |
GenBank Accession Number | BC007422 |
Gene Symbol | ACP1 |
Gene ID (NCBI) | 52 |
RRID | AB_2879032 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P24666 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Human red cell acid phosphatase (ACP1) is a polymorphic enzyme closely related to cytosolic low molecular weight acid phosphatases, a protein family broadly conserved among eukaryotes. It catalyses the transfer of phosphate from phosphate ester substrates to suitable acceptor alcohols such as methanol and glycerol. This protein has 3 isoforms produced by alternative splicing.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ACP1 antibody 22214-1-AP | Download protocol |
IHC protocol for ACP1 antibody 22214-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |