ACSL1 Recombinant monoclonal antibody

ACSL1 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 87427-1-RR
Clone No.251988E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

ACS1, Acyl CoA synthetase 1, Acyl-CoA synthetase 1, Arachidonate--CoA ligase, EC:6.2.1.15

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, rat liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

87427-1-RR targets ACSL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5059

Product name: Recombinant human ACSL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 349-698 aa of BC050073

Sequence: RLLMDDLKVLQPTVFPVVPRLLNRMFDRIFGQANTTLKRWLLDFASKRKEAELRSGIIRNNSLWDRLIFHKVQSSLGGRVRLMVTGAAPVSATVLTFLRAALGCQFYEGYGQTECTAGCCLTMPGDWTAGHVGAPMPCNLIKLVDVEEMNYMAAEGEGEVCVKGPNVFQGYLKDPAKTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYMRSEPVAQVFVHGESLQAFLIAIVVPDVETLCSWAQKRGFEGSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNGLLTPTMKAKRPELRNYFRSQIDDLYSTIKV

Predict reactive species
Full Name acyl-CoA synthetase long-chain family member 1
Calculated Molecular Weight 78 kDa
Observed Molecular Weight 70-75 kDa
GenBank Accession NumberBC050073
Gene Symbol ACSL1
Gene ID (NCBI) 2180
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP33121
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACSL1(Long-chain-fatty-acid--CoA ligase 1) is also named as FACL1, FACL2, LACS, LACS1, LACS2 and belongs to the ATP-dependent AMP-binding enzyme family. ACSL1 is a 75 kDa protein that is associated peripherally with the plasma membrane(Brian M Wiczer, etc., 2006). ACSL1 is abundantly expressed in tissues, such as liver and brown fat, that metabolize substantial amounts of triglycerides as fuel, and as such, a deficiency in ACSL1 function could have a more profound affect in those cells, resulting in hepatosteatosis and potentially increased very low density lipoprotein production by the liver or decreased thermogenic capacity in brown adipose tissue(PMID:19429676). An anti-rat ACSL1 antibody recognized a band of the predicted 68 kDa in high-speed supernatant from rat liver and in human and murine SMCs, monocyte-derived macrophages, and murine peritoneal macrophages (PMID:17259370). It has 2 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
WB protocol for ACSL1 antibody 87427-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...