Tested Applications
| Positive WB detected in | DU 145 cells, HuH-7 cells, LNCaP cells, MKN-45 cells, mouse kidney tissue |
| Positive IP detected in | LNCaP cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
30214-1-AP targets ACSL3 in WB, IP, ELISA applications and shows reactivity with Human, mouse samples.
| Tested Reactivity | Human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33005 Product name: Recombinant human ACSL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 602-675 aa of BC041692 Sequence: KNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFE Predict reactive species |
| Full Name | acyl-CoA synthetase long-chain family member 3 |
| Calculated Molecular Weight | 80 kDa |
| Observed Molecular Weight | 72 kDa |
| GenBank Accession Number | BC041692 |
| Gene Symbol | ACSL3 |
| Gene ID (NCBI) | 2181 |
| RRID | AB_2935532 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95573 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ACSL3, also named as ACS3, FACL3 and LACS3, belongs to the ATP-dependent AMP-binding enzyme family. Acyl-CoA synthetases (ACSL) activate long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL3 mediates hepatic lipogenesis. Preferentially uses myristate, laurate, arachidonate and eicosapentaenoate as substrates. Has mainly an anabolic role in energy metabolism. Required for the incorporation of fatty acids into phosphatidylcholine, the major phospholipid located on the surface of VLDL (very low density lipoproteins). The antibody is specific to ACSL3.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for ACSL3 antibody 30214-1-AP | Download protocol |
| WB protocol for ACSL3 antibody 30214-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biochem Biophys Res Commun AP1S3 affects lipid metabolism in breast cancer cells by regulating the PI3K/AKT/mTOR pathway | ||
Antioxid Redox Signal Exosomal miR-196a-5p Secreted by Bone Marrow Mesenchymal Stem Cells Inhibits Ferroptosis and Promotes Drug Resistance of Acute Myeloid Leukemia |





