ACSL5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of rat liver using 86982-1-RR (same clone as 86982-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 86982-1-RR (ACSL5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86982-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 86982-1-RR (same clone as 86982-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 86982-1-RR (ACSL5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86982-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86982-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86982-1-RR against Human ACSL5 were performed. The affinity constant is below 1 pM.

ACSL5 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86982-1-PBS

Clone No.252098G2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

ACSL 5, Arachidonate--CoA ligase, EC:6.2.1.15, EC:6.2.1.3, FACL5

---

Product Information

86982-1-PBS targets ACSL5 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8258

  Product name: Recombinant human ACSL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 388-739 aa of BC007985

  Sequence: DIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD

• Full Name: acyl-CoA synthetase long-chain family member 5
• Calculated Molecular Weight: 76 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC007985
• Gene Symbol: ACSL5
• Gene ID (NCBI): 51703
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9ULC5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.