ACSM5 Recombinant monoclonal antibody

• 

  WB analysis using 84444-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84444-1-RR (ACSM5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 84444-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 84444-1-RR (ACSM5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of HepG2 using 84444-1-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug ACSM5 Recombinant antibody (84444-1-RR, Clone:241400E7) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• 

  Affinity and Kinetic Characterization of 84444-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84444-1-RR against Human ACSM5 were performed. The affinity constant is below 1 pM.

ACSM5 Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 84444-1-RR

Clone No.241400E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

241400E7, ACSM 5, Acyl-CoA synthetase medium-chain family member 5, Acyl-coenzyme A synthetase ACSM5, mitochondrial, EC:6.2.1.2

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue, human kidney tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84444-1-RR targets ACSM5 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9373

  Product name: Recombinant human ACSM5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-208 aa of BC016703

  Sequence: MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYFNFAHDVLDVWSRLEEAGHRPPNPAFWWVNGTGAEIKWSFEELGKQSRKAANVLGGACGLQPGDRMMLVLPRLPEWWLVSVACMRTGTVVIPGVTQLTEKDLKYRLQASRAKSIITSDSLAPRVDAISAECPSLQTKLLVSDSSRPGWLNFRELLR

• Full Name: acyl-CoA synthetase medium-chain family member 5
• Calculated Molecular Weight: 208 aa, 23 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC016703
• Gene Symbol: ACSM5
• Gene ID (NCBI): 54988
• RRID: AB_3671969
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q6NUN0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACSM5(Acyl-CoA synthetase medium-chain family member 5) is also named as MACS3 and belongs to the ATP-dependent AMP-binding enzyme family. ACSM5 has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). This protein has 2 isoforms produced by alternative splicing.