ACSM5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84444-1-RR (same clone as 84444-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84444-1-RR (ACSM5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84444-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 84444-1-RR (same clone as 84444-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 84444-1-RR (ACSM5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84444-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 84444-1-RR (same clone as 84444-1-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug ACSM5 Recombinant antibody (84444-1-RR, Clone:241400E7) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84444-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84444-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84444-1-RR against Human ACSM5 were performed. The affinity constant is below 1 pM.

ACSM5 Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 84444-1-PBS

Clone No.241400E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

241400E7, ACSM 5, Acyl-CoA synthetase medium-chain family member 5, Acyl-coenzyme A synthetase ACSM5, mitochondrial, EC:6.2.1.2

---

Product Information

84444-1-PBS targets ACSM5 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9373

  Product name: Recombinant human ACSM5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-208 aa of BC016703

  Sequence: MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYFNFAHDVLDVWSRLEEAGHRPPNPAFWWVNGTGAEIKWSFEELGKQSRKAANVLGGACGLQPGDRMMLVLPRLPEWWLVSVACMRTGTVVIPGVTQLTEKDLKYRLQASRAKSIITSDSLAPRVDAISAECPSLQTKLLVSDSSRPGWLNFRELLR

• Full Name: acyl-CoA synthetase medium-chain family member 5
• Calculated Molecular Weight: 208 aa, 23 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC016703
• Gene Symbol: ACSM5
• Gene ID (NCBI): 54988
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q6NUN0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ACSM5(Acyl-CoA synthetase medium-chain family member 5) is also named as MACS3 and belongs to the ATP-dependent AMP-binding enzyme family. ACSM5 has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). This protein has 2 isoforms produced by alternative splicing.