ACTR8 Monoclonal antibody

• 

  WB analysis using 68784-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68784-1-Ig (ACTR8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of LNCaP using 68784-1-Ig

  LNCaP cells were subjected to SDS PAGE followed by western blot with 68784-1-Ig (ACTR8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

ACTR8 Monoclonal Antibody for WB, ELISA

Cat No. 68784-1-Ig

Clone No.2B3B2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, ELISA

Synonyms

2B3B2, Actin related protein 8, Actin-related protein 8, ARP8, hArp8

---

Tested Applications

• Positive WB detected in: HEK-293T cells, LNCaP cells, Jurkat cells, K-562 cells, Daudi cells, HSC-T6 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68784-1-Ig targets ACTR8 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34088

  Product name: Recombinant human ACTR8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-329 aa of BC032744

  Sequence: MILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSHRNTRIFSWNQDISGLQDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHRSQGDPEDPHDEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLGSAQGDGLMAGNDSEEALTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDDTKKKMYSSILVVGGGLMFHKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGAVLACLDTTQELWIYQREWQRFGVRMLRERAAFVW

• Full Name: ARP8 actin-related protein 8 homolog (yeast)
• Calculated Molecular Weight: 329 aa, 37 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC032744
• Gene Symbol: ACTR8
• Gene ID (NCBI): 93973
• RRID: AB_3670427
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9H981
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.