ACTRT3/ARPM1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68372-1-Ig (same clone as 68372-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68372-1-Ig (ARPM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68372-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68372-1-Ig (same clone as 68372-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68372-1-Ig (ARPM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68372-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 68372-1-Ig (same clone as 68372-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 68372-1-Ig (ARPM1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68372-1-PBS in a different storage buffer formulation.

ACTRT3/ARPM1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 68372-1-PBS

Clone No.3B2B10

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat, rabbit

Applications

WB, IHC, Indirect ELISA

Synonyms

actin related protein M1, ARPM1

---

Product Information

68372-1-PBS targets ACTRT3/ARPM1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, rat, rabbit samples.

• Tested Reactivity: Human, rat, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33162

  Product name: Recombinant human ARPM1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 16-233 aa of BC007289

  Sequence: MIKAGVAGCREPQFIYPNIIGRAKGQSRAAQGGLELCVGDQAQDWRSSLFISYPVERGLITSCEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQAVLALFAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTNYLMVLMKNHGIMLLSASDRKIVEDIKESFCYVAMNYEEEMAKKPDCL

• Full Name: actin related protein M1
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC007289
• Gene Symbol: ACTRT3/ARPM1
• Gene ID (NCBI): 84517
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BYD9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.