ACTRT3/ARPM1 Monoclonal antibody

• 

  WB analysis using 68372-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68372-1-Ig (ARPM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 68372-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68372-1-Ig (ARPM1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 68372-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 68372-1-Ig (ARPM1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ACTRT3/ARPM1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 68372-1-Ig

Clone No.3B2B10

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat, rabbit

Applications

WB, IHC, ELISA

Synonyms

actin related protein M1, ARPM1

---

Tested Applications

• Positive WB detected in: NCCIT cells, Rabbit testis, Rat testis, Human testis
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68372-1-Ig targets ACTRT3/ARPM1 in WB, IHC, ELISA applications and shows reactivity with Human, rat, rabbit samples.

• Tested Reactivity: Human, rat, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33162

  Product name: Recombinant human ARPM1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 16-233 aa of BC007289

  Sequence: MIKAGVAGCREPQFIYPNIIGRAKGQSRAAQGGLELCVGDQAQDWRSSLFISYPVERGLITSCEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQAVLALFAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTNYLMVLMKNHGIMLLSASDRKIVEDIKESFCYVAMNYEEEMAKKPDCL

• Full Name: actin related protein M1
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC007289
• Gene Symbol: ACTRT3/ARPM1
• Gene ID (NCBI): 84517
• RRID: AB_3085092
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BYD9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.