Use Able AI chat for product recommendations

ACVR1 Monoclonal antibody

ACVR1 Monoclonal Antibody for ELISA

Cat No. 60014-1-Ig
Clone No.2G1B1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

ELISA

activin A receptor, type I, Activin receptor like kinase 2, Activin receptor type 1, Activin receptor type I, Activin Receptor Type IA, ACTR I, ACTRI, ACVR1, ACVR1A, ACVRLK2, ALK 2, ALK2, FOP, SKR1, TSR I, TSRI

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60014-1-Ig targets ACVR1 in ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1556

Product name: Recombinant human ACVR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 210-509 aa of BC033867

Sequence: LLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

Predict reactive species
Full Name activin A receptor, type I
Calculated Molecular Weight 509 aa, 57 kDa
Observed Molecular Weight 57 kDa
GenBank Accession NumberBC033867
Gene Symbol ACVR1
Gene ID (NCBI) 90
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ04771
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACVR1 (activin receptor type I), also known as ALK2 or ACTRI, is a receptor for activin. It forms a stable complex with type II receptor after ligand binding. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. ACVR1 is expressed in many tissues including skeletal muscle and chondrocytes. It functions as a receptor for bone morphogenetic protein (BMP) and induces Indian hedgehog in chondrocytes during skeletal development. Mutations in ACVR1 gene are associated with fibrodysplasia ossificans progressive (PMID: 16642017).

Publications

SpeciesApplicationTitle

CNS Neurosci Ther

Multiple sevoflurane exposures during mid-trimester induce neurotoxicity in the developing brain initiated by 15LO2-Mediated ferroptosis

Authors - Qian Jiang
Loading...
||
New chat

Able

正在加载,请稍候...