Important Customer Notice Regarding Covid-19 Outbreak. Read more.

ACVR1 Fusion Protein

Catalog number: Ag13508

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

ACVR1 fusion protein Ag13508 SDS-PAGE


Product Name:
human ACVR1-6*His fusion protein

Catalog No:
Ag13508

Source:
E. coli-derived, PET28a

Peptide Sequence:
LLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC
(210-509 aa encoded by BC033867)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top