ACVRL1 Recombinant monoclonal antibody, PBS Only (Capture)

ACVRL1 Uni-rAb® Recombinant Antibody for IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84421-1-PBS
Clone No.241686B9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

241686B9, Activin receptor like kinase 1, Activin receptor-like kinase 1, ACVRLK1, ALK 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84421-1-PBS targets ACVRL1 as part of a matched antibody pair:

MP01306-2: 84421-1-PBS capture and 84421-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2132

Product name: Recombinant Human ACVRL1 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 22-118 aa of BC042637

Sequence: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ

Predict reactive species
Full Name activin A receptor type II-like 1
Calculated Molecular Weight 56 kDa
GenBank Accession NumberBC042637
Gene Symbol ACVRL1
Gene ID (NCBI) 94
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP37023
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ACVRL1 (also known as ALK1) is a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. ACVRL1 is highly expressed in endothelial cells and has a critical role in the control of blood vessel development and repair (PMID: 8640225). Mutations in the ACVRL1 gene are associated with hemorrhagic telangiectasia type 2.

Loading...
||
New chat Able
正在加载,请稍候...